PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000457620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB_related
Protein Properties Length: 394aa    MW: 44216.8 Da    PI: 6.5918
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000457620genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.82.9e-14107148346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T+ E+el+v++++  G++ W +Ia+ ++ gRt++++k++w++
    MDP0000457620 107 SFTPHEEELIVRLHATIGSR-WPAIAQQLP-GRTDNDVKNYWNT 148
                      79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-784112IPR009057Homeodomain-like
SuperFamilySSF466891.18E-1885157IPR009057Homeodomain-like
PROSITE profilePS5129420.654100154IPR017930Myb domain
SMARTSM007172.8E-13104152IPR001005SANT/Myb domain
CDDcd001673.17E-10107150No hitNo description
PfamPF002491.6E-12107148IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-19113151IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MATSTDRAIS LGHPRLSKPK RWTGSVTIFS NATRLFIKCM TSLTEDARAR YTKEMDMKKS  60
RQKDNGRDVE EMHKERYTXV FTGITRCGKS SRLRWPNHLK PNLKHESFTP HEEELIVRLH  120
ATIGSRWPAI AQQLPGRTDN DVKNYWNTKL KKKLSEMGID PVTHKPFSQV LXDYGNIGGL  180
PKVGMRIGIG SLNKDLKNAM LMEPAEPYLL XAQGFSNINS HLMPITMIPT KEEPILDSFL  240
GHNQPSSQPP DLLTQLQAIK LVTEASKSTE FQSSAPNFYS HEGXLSSPSS TSSSAAQEQA  300
TLQTFSWSDF LLEDAFMPIG DAQEHKNKGE YSSKNIAQVA VQQSQIDMDY AISSNEVEAT  360
SPACDSSFVX AMVSLENEMF LEFPELMEEP FYY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-186315412108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008346824.10.0PREDICTED: transcription factor MYB39-like
TrEMBLM5WT281e-165M5WT28_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s07900.14e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.14e-41myb domain protein 103